Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C1QTNF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-329 of human C1QTNF4 (NP_114115.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against C1QTNF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-329 of human C1QTNF4 (NP_114115.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01078A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C1QTNF4 |
| Target Synonyms | CTRP4; ZACRP4; C1QTNF4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-329 of human C1QTNF4 (NP_114115.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NRDEVQAMIYDDGASRRREMQSQSVMLALRRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAPAAPPGLGASELL | Uniprot ID | Q9BXJ3 |
Uniprot Id
Q9BXJ3
Target Species
Human
Target Name
C1QTNF4
Target Full Name
Complement C1q tumor necrosis factor-related protein 4
Target Function
May be involved in the regulation of the inflammatory network. Its role as pro- or anti-inflammatory seems to be context dependent. Seems to have some role in regulating food intake and energy balance when administered in the brain. This effect is sustained over a two-day period, and it is accompanied by decreased expression of orexigenic neuropeptides in the hypothalamus 3 hours post-injection.
Target Subcellular Location
Secreted.
Target Tissue Specificity
Widely expressed at low levels. Highest levels in adipocyte tissue and brain.
Target Synonyms
C1QTNF4; CTRP4Complement C1q tumor necrosis factor-related protein 4; C1q/TNF-related protein 4
Target Background
Predicted to enable cytokine activity. Involved in positive regulation of cytokine production and positive regulation of signal transduction. Located in extracellular space.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
