Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CACNG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human CACNG1 (NP_000718.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CACNG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human CACNG1 (NP_000718.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Immunofluorescence analysis of C6 cells using CACNG1 Rabbit pAb at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-08965A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CACNG1 |
| Target Synonyms | CACNLG; CACNG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Mouse skeletal muscle, Rat kidney, Rat liver, Rat skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-110 of human CACNG1 (NP_000718.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI | Uniprot ID | Q06432 |
Uniprot Id
Q06432
Target Species
Human
Target Name
CACNG1
Target Full Name
Voltage-dependent calcium channel gamma-1 subunit
Target Function
Regulatory subunit of the voltage-gated calcium channel that gives rise to L-type calcium currents in skeletal muscle. Regulates channel inactivation kinetics.
Target Subcellular Location
Cell membrane, sarcolemma; Multi-pass membrane protein.
Target Protein Families
PMP-22/EMP/MP20 family, CACNG subfamily
Target Tissue Specificity
Skeletal muscle.
Target Research Area
Neuroscience
Target Synonyms
CACNG1; CACNLG; Voltage-dependent calcium channel gamma-1 subunit; Dihydropyridine-sensitive L-type, skeletal muscle calcium channel subunit gamma
Target Background
Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1, 4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
