Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CALML5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human CALML5 (NP_059118.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CALML5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human CALML5 (NP_059118.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01931A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CALML5 |
| Target Synonyms | CLSP; CALML5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-146 of human CALML5 (NP_059118.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE | Uniprot ID | Q9NZT1 |
Uniprot Id
Q9NZT1
Target Species
Human
Target Name
CALML5
Target Full Name
Calmodulin-like protein 5
Target Function
Binds calcium. May be involved in terminal differentiation of keratinocytes.
Target Tissue Specificity
Particularly abundant in the epidermis where its expression is directly related to keratinocyte differentiation. Very low expression in lung.
Target Research Area
Cell Biology
Target Synonyms
CALL5_HUMAN; CALML5; Calmodulin like 5; Calmodulin-like protein 5; Calmodulin-like skin protein; CLSP
Target Background
This gene encodes a novel calcium binding protein expressed in the epidermis and related to the calmodulin family of calcium binding proteins. Functional studies with recombinant protein demonstrate it does bind calcium and undergoes a conformational change when it does so. Abundant expression is detected only in reconstructed epidermis and is restricted to differentiating keratinocytes. In addition, it can associate with transglutaminase 3, shown to be a key enzyme in the terminal differentiation of keratinocytes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
