-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CAMK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 304-473 of human CAMK4 (NP_001735.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CAMK4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 304-473 of human CAMK4 (NP_001735.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01677A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CAMK4 |
| Target Synonyms | caMK; CaMKIV; CaMK IV; CaMK-GR; CAMK4 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 304-473 of human CAMK4 (NP_001735.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPSPIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY | Uniprot ID | Q16566 |
Uniprot Id
Q16566
Target Species
Human
Target Name
CAMK4
Target Full Name
Calcium/calmodulin-dependent protein kinase type IV
Target Function
Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK4 signaling cascade and regulates, mainly by phosphorylation, the activity of several transcription activators, such as CREB1, MEF2D, JUN and RORA, which play pivotal roles in immune response, inflammation, and memory consolidation. In the thymus, regulates the CD4(+)/CD8(+) double positive thymocytes selection threshold during T-cell ontogeny. In CD4 memory T-cells, is required to link T-cell antigen receptor (TCR) signaling to the production of IL2, IFNG and IL4 (through the regulation of CREB and MEF2). Regulates the differentiation and survival phases of osteoclasts and dendritic cells (DCs). Mediates DCs survival by linking TLR4 and the regulation of temporal expression of BCL2. Phosphorylates the transcription activator CREB1 on 'Ser-133' in hippocampal neuron nuclei and contribute to memory consolidation and long term potentiation (LTP) in the hippocampus. Can activate the MAP kinases MAPK1/ERK2, MAPK8/JNK1 and MAPK14/p38 and stimulate transcription through the phosphorylation of ELK1 and ATF2. Can also phosphorylate in vitro CREBBP, PRM2, MEF2A and STMN1/OP18.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Target Tissue Specificity
Expressed in brain, thymus, CD4 T-cells, testis and epithelial ovarian cancer tissue.
Target Synonyms
Brain Ca(2+) calmodulin dependent protein kinase type 4; Brain Ca(2+) calmodulin dependent protein kinase type IV; Brain Ca++-calmodulin dependent protein kinase type IV; Calcium / calmodulin dependent protein kinase type 4 catalytic chain; Calcium / calmodulin dependent protein kinase type IV catalytic chain; Calcium/calmodulin dependent protein kinase IV ; Calcium/calmodulin dependent protein kinase type IV; Calcium/calmodulin-dependent protein kinase type IV; CAM kinase 4; CAM kinase GR; CAM kinase IV; CAM kinase-GR; CaMK 4; CAMK GR; CaMK IV; Camk4; CaMKGR ; IV; KCC4_HUMAN; MGC36771
Target Background
The product of this gene belongs to the serine/threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This enzyme is a multifunctional serine/threonine protein kinase with limited tissue distribution, that has been implicated in transcriptional regulation in lymphocytes, neurons and male germ cells.
Notification