-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Caspase-3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-160 of human Caspase-3 (NP_004337.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Caspase-3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 55-160 of human Caspase-3 (NP_004337.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-17279A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Caspase-3 |
| Target Synonyms | CPP32; SCA-1; CPP32B; -3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 55-160 of human Caspase-3 (NP_004337.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII | Uniprot ID | P42574 |
Uniprot Id
P42574
Target Species
Human
Target Name
CASP3
Target Full Name
Caspase-3
Target Function
Involved in the activation cascade of caspases responsible for apoptosis execution. At the onset of apoptosis it proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Cleaves and activates sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Cleaves and activates caspase-6, -7 and -9. Involved in the cleavage of huntingtin. Triggers cell adhesion in sympathetic neurons through RET cleavage. Cleaves and inhibits serine/threonine-protein kinase AKT1 in response to oxidative stress. Cleaves XRCC4 and phospholipid scramblase proteins XKR4, XKR8 and XKR9, leading to promote phosphatidylserine exposure on apoptotic cell surface.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Peptidase C14A family
Target Tissue Specificity
Highly expressed in lung, spleen, heart, liver and kidney. Moderate levels in brain and skeletal muscle, and low in testis. Also found in many cell lines, highest expression in cells of the immune system.
Target Research Area
Apoptosis
Target Synonyms
A830040C14Rik; Apopain; CASP 3; CASP-3; CASP3; CASP3_HUMAN; Casp3a; Caspase 3; Caspase 3; apoptosis-related cysteine peptidase; Caspase 3; apoptosis-related cysteine protease; Caspase 3; apoptosis-related cysteine protease a; Caspase-3 subunit p12; Caspase3; CC3; CPP 32; CPP-32; CPP32; CPP32B; Cysteine protease CPP32; EC 3.4.22.56; ICE3; LICE; mldy; OTTHUMP00000165052; OTTHUMP00000165053; OTTHUMP00000165054; PARP cleavage protease; Procaspase3; Protein Yama; SCA 1; SCA-1; SCA1; SREBP cleavage activity 1; Yama; Yama protein
Target Background
The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.
Notification