Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CAT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC7A1(NP_003036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CAT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC7A1(NP_003036.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08537A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CAT1 |
| Target Synonyms | ERR; ATRC1; CAT-1; HCAT1; REC1L | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SLC7A1(NP_003036.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VLGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLNNDTKEGKPGVGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIA | Uniprot ID | P30825 |
Uniprot Id
P30825
Target Species
Human
Target Name
SLC7A1
Target Full Name
High affinity cationic amino acid transporter 1
Target Function
High-affinity, low capacity permease involved in the transport of the cationic amino acids (arginine, lysine and ornithine) in non-hepatic tissues.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Amino acid-polyamine-organocation (APC) superfamily, Cationic amino acid transporter (CAT) (TC 2.A.3.3) family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Amino acid transporter cationic 1; ATRC1; CAT-1; CaT1; CTR1_HUMAN; Ecotropic retroviral leukemia receptor homolog; Ecotropic retroviral receptor; Ecotropic retrovirus receptor homolog; ERR; HCAT1; High affinity cationic amino acid transporter 1; High-affinity cationic amino acid transporter-1; REC1L; Slc7a1; Solute carrier family 7 (cationic amino acid transporter, y+ system) member 1; Solute carrier family 7 member 1; System Y+ basic amino acid transporter
Target Background
Enables L-arginine transmembrane transporter activity and L-histidine transmembrane transporter activity. Involved in amino acid transport. Located in membrane. Part of apical plasma membrane; basolateral plasma membrane; and protein-containing complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
