-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD162/PSGL-1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 348-412 of human CD162/PSGL-1 (NP_002997.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD162/PSGL-1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 348-412 of human CD162/PSGL-1 (NP_002997.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09976A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD162/PSGL-1 |
| Target Synonyms | CLA; CD162; PSGL1; PSGL-1; CD162/PSGL-1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 348-412 of human CD162/PSGL-1 (NP_002997.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGHMYPVRNYSPTEMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP | Uniprot ID | Q14242 |
Uniprot Id
Q14242
Target Species
Human
Target Name
SELPLG
Target Full Name
P-selectin glycoprotein ligand 1
Target Function
A SLe(x)-type proteoglycan, which through high affinity, calcium-dependent interactions with E-, P- and L-selectins, mediates rapid rolling of leukocytes over vascular surfaces during the initial steps in inflammation. Critical for the initial leukocyte capture.; (Microbial infection) Acts as a receptor for enterovirus 71.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed on neutrophils, monocytes and most lymphocytes.
Target Synonyms
CD 162; CD162; CD162 antigen; CLA; Cutaneous lymphocyte associated associated antigen; P selectin glycoprotein ligand 1; P selectin glycoprotein ligand 1 precursor ; P-selectin glycoprotein ligand 1; PSGL 1; PSGL-1; PSGL1; Selectin P ligand; SELPL_HUMAN; SELPLG
Target Background
This gene encodes a glycoprotein that functions as a high affinity counter-receptor for the cell adhesion molecules P-, E- and L- selectin expressed on myeloid cells and stimulated T lymphocytes. As such, this protein plays a critical role in leukocyte trafficking during inflammation by tethering of leukocytes to activated platelets or endothelia expressing selectins. This protein requires two post-translational modifications, tyrosine sulfation and the addition of the sialyl Lewis x tetrasaccharide (sLex) to its O-linked glycans, for its high-affinity binding activity. Aberrant expression of this gene and polymorphisms in this gene are associated with defects in the innate and adaptive immune response. Alternate splicing results in multiple transcript variants.
Notification