-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD168/RHAMM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-440 of human CD168/RHAMM (NP_001136028.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD168/RHAMM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 341-440 of human CD168/RHAMM (NP_001136028.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04334A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD168/RHAMM |
| Target Synonyms | CD168; IHABP; RHAMM; CD168/RHAMM | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung, Mouse small intestine, Mouse spleen, Mouse thymus, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 341-440 of human CD168/RHAMM (NP_001136028.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQIDSLLQQEKELSSSLHQKLCSFQEEMVKEKNLFEEELKQTLDELDKLQQKEEQAERLVKQLEEEAKSRAEELKLLEEKLKGKEAELEKSSAAHTQATL | Uniprot ID | O75330 |
Uniprot Id
O75330
Target Species
Human
Target Name
HMMR
Target Full Name
Hyaluronan mediated motility receptor
Target Function
Receptor for hyaluronic acid (HA). Involved in cell motility. When hyaluronan binds to HMMR, the phosphorylation of a number of proteins, including PTK2/FAK1 occurs. May also be involved in cellular transformation and metastasis formation, and in regulating extracellular-regulated kinase (ERK) activity. May act as a regulator of adipogenisis.
Target Subcellular Location
Cell surface. Cytoplasm. Cytoplasm, cytoskeleton, spindle.
Target Tissue Specificity
Expressed in testis. Expressed in the breast.
Target Synonyms
CD168; CD168 antigen; HMMR; HMMR_HUMAN; Hyaluronan mediated motility receptor; Hyaluronan-mediated motility receptor (RHAMM); IHABP; Intracellular hyaluronic acid-binding protein; MGC119494; MGC119495; OTTHUMP00000196920; Receptor for hyaluronan-mediated motility; RHAMM
Target Background
The protein encoded by this gene is involved in cell motility. It is expressed in breast tissue and together with other proteins, it forms a complex with BRCA1 and BRCA2, thus is potentially associated with higher risk of breast cancer. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Notification