Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD248 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human CD248 (NP_065137.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD248 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human CD248 (NP_065137.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03196A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD248 |
| Target Synonyms | TEM1; CD164L1; CD248 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-375, Mouse spleen, Mouse thymus, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 18-150 of human CD248 (NP_065137.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QDPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLA | Uniprot ID | Q9HCU0 |
Uniprot Id
Q9HCU0
Target Species
Human
Target Name
CD248
Target Full Name
Endosialin
Target Function
May play a role in tumor angiogenesis.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Expressed in tumor endothelial cells but absent or barely detectable in normal endothelial cells. Expressed in metastatic lesions of the liver and during angiogenesis of corpus luteum formation and wound healing. Expressed in vascular endothelial cells of
Target Synonyms
CD164 sialomucin like 1; CD164L1; CD248; CD248 antigen endosialin; CD248 molecule endosialin; CD248_HUMAN; Endosialin; TEM 1; TEM1; Tumor endothelial marker 1
Target Background
Predicted to enable extracellular matrix binding activity and extracellular matrix protein binding activity. Predicted to be involved in cell migration. Predicted to act upstream of or within several processes, including anatomical structure regression; lymph node development; and positive regulation of endothelial cell apoptotic process. Located in extracellular exosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
