Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD300C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-183 of human CD300C (NP_006669.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CD300C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-183 of human CD300C (NP_006669.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06440A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD300C |
| Target Synonyms | LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1; CD300C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, A-549, Jurkat, PC-12, Raji, THP-1 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-183 of human CD300C (NP_006669.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR | Uniprot ID | Q08708 |
Uniprot Id
Q08708
Target Species
Human
Target Name
CD300C
Target Full Name
CMRF35-like molecule 6
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
CD300 family
Target Tissue Specificity
Present on the surface of monocytes, neutrophils, a proportion of peripheral blood T- and B-lymphocytes and lymphocytic cell lines.
Target Synonyms
LIR; CLM-6; CMRF35; IGSF16; CMRF-35; CMRF35A; CMRF-35A; CMRF35A1; CMRF35-A1; CD300C
Target Background
The CMRF35 antigen, which was identified by reactivity with a monoclonal antibody, is present on monocytes, neutrophils, and some T and B lymphocytes (Jackson et al., 1992 [PubMed 1349532]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
