-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD3H was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3H (P20963) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.
The antibody against CD3H was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3H (P20963) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.
| Cat.No | ADA-15996A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD3H |
| Target Synonyms | T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3ZETA; CD3-ZETA | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB, FC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3H (P20963). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR | Uniprot ID | P20963 |
Uniprot Id
P20963
Target Species
Human
Target Name
CD247
Target Full Name
T-cell surface glycoprotein CD3 zeta chain
Target Function
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN).
Target Involvement
Immunodeficiency 25 (IMD25)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
CD3Z/FCER1G family
Target Tissue Specificity
CD3Z is expressed in normal lymphoid tissue and in peripheral blood mononuclear cells (PBMCs).
Target Synonyms
CD247; CD3Z; T3Z; TCRZ; T-cell surface glycoprotein CD3 zeta chain; T-cell receptor T3 zeta chain; CD antigen CD247
Target Background
The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Notification