-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CELF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 230-380 of human CELF6 (NP_443072.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CELF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 230-380 of human CELF6 (NP_443072.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07078A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CELF6 |
| Target Synonyms | BRUNOL6; CELF6 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse large intestine, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 230-380 of human CELF6 (NP_443072.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGAFHPAPLPLGACGAYTTAILQHQAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGPGTLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLSPYPAQSPGVADPLQQAYAGMHHYAAAYPSAYAPVSTAFPQ | Uniprot ID | Q96J87 |
Uniprot Id
Q96J87
Target Species
Human
Target Name
CELF6
Target Full Name
CUGBP Elav-like family member 6
Target Function
RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of TNNT2 in a muscle-specific splicing enhancer (MSE)-dependent manner. Promotes also exon exclusion of INSR pre-mRNA.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
CELF/BRUNOL family
Target Tissue Specificity
Expressed mainly in kidney, brain and testis and present in other tissues albeit at lower levels. Also expressed in fetal kidney.
Target Synonyms
6330569O16Rik; Bruno like 6; RNA binding protein (Drosophila); bruno like 6; RNA binding protein; Bruno like protein 6; Bruno-like protein 6; BRUNOL6; CELF-6; Celf6; CELF6_HUMAN; CUG-BP- and ETR-3-like factor 6; CUGBP and ETR3 like factor 6; CUGBP Elav-like family member 6; RNA binding protein BRUNOL 6; RNA-binding protein BRUNOL-6
Target Background
Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene.
Notification