Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CGRRF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human CGRRF1 (NP_006559.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CGRRF1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human CGRRF1 (NP_006559.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06976A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CGRRF1 |
| Target Synonyms | CGR19; RNF197; CGRRF1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-170 of human CGRRF1 (NP_006559.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VPVILRNSEETQFSTRVFKKQMRQVKNPFGLEITNPSSASITTGITLTTDCLEDSLLTCYWGCSVQKLYEALQKHVYCFRISTPQALEDALYSEYLYQEQYFIKKDSKEEIYCQLPRDTKIEDFGTVPRSR | Uniprot ID | Q99675 |
Uniprot Id
Q99675
Target Species
Human
Target Name
CGRRF1
Target Full Name
Cell growth regulator with RING finger domain protein 1
Target Function
Able to inhibit growth in several cell lines.
Target Subcellular Location
Nucleus. Endoplasmic reticulum.
Target Tissue Specificity
Ubiquitously expressed with high expression in testis and the cerebellum.
Target Synonyms
CGRRF1; CGR19; RNF197Cell growth regulator with RING finger domain protein 1; Cell growth regulatory gene 19 protein; RING finger protein 197
Target Background
Predicted to enable metal ion binding activity. Predicted to be involved in negative regulation of cell growth. Located in endoplasmic reticulum and nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
