Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1729-1828 of human CHD2 (NP_001262.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1729-1828 of human CHD2 (NP_001262.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06222A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHD2 |
| Target Synonyms | EEOC; DEE94; CHD2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1729-1828 of human CHD2 (NP_001262.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DEFRPQNYHQQDFRRMSDHRPAMGYHGQGPSDHYRSFHTDKLGEYKQPLPPLHPAVSDPRSPPSQKSPHDSKSPLDHRSPLERSLEQKNNPDYNWNVRKT | Uniprot ID | O14647 |
Uniprot Id
O14647
Target Species
Human
Target Name
CHD2
Target Full Name
Chromodomain-helicase-DNA-binding protein 2
Target Function
DNA-binding helicase that specifically binds to the promoter of target genes, leading to chromatin remodeling, possibly by promoting deposition of histone H3.3. Involved in myogenesis via interaction with MYOD1: binds to myogenic gene regulatory sequences and mediates incorporation of histone H3.3 prior to the onset of myogenic gene expression, promoting their expression.
Target Involvement
Epileptic encephalopathy, childhood-onset (EEOC)
Target Subcellular Location
Nucleus.
Target Protein Families
SNF2/RAD54 helicase family
Target Synonyms
2810013C04Rik; 2810040A01Rik; 5630401D06Rik; AI851092; ATP dependent helicase CHD2; ATP-dependent helicase CHD2; BC029703; CHD 2; CHD-2; CHD2; CHD2_HUMAN; chromodomain helicase dna binding protein; Chromodomain-helicase-DNA-binding protein 2; DKFZp547I1315; DKFZp686E01200 ; DKFZP781D1727; EC 3.6.1.-; EEOC; FLJ38614
Target Background
The CHD family of proteins is characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. CHD genes alter gene expression possibly by modification of chromatin structure thus altering access of the transcriptional apparatus to its chromosomal DNA template. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
