Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CIDEB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-160 of human CIDEB (NP_001305736) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CIDEB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-160 of human CIDEB (NP_001305736) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06063A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CIDEB |
| Target Synonyms | CIDEB; cell death activator CIDE-B; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; HCELL; HUTCH-I; ECMR-III | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-160 of human CIDEB (NP_001305736). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLY | Uniprot ID | Q9UHD4 |
Uniprot Id
Q9UHD4
Target Species
Human
Target Name
CIDEB
Target Full Name
Lipid transferase CIDEB
Target Function
Activates apoptosis.; (Microbial infection) Involved in Hepatatis C virus (HCV) assembly and required for HCV entry into hepatocytes.
Target Tissue Specificity
Highly expressed in liver and small intestine and, at lower levels, in colon, kidney and spleen.
Target Synonyms
Cell death activator CIDE B; Cell death activator CIDE-B; Cell death inducing DFFA like effector B ; Cell death-inducing DFFA-like effector B; CIDEB; CIDEB_HUMAN
Target Background
Enables identical protein binding activity. Involved in activation of cysteine-type endopeptidase activity; positive regulation of cell death; and positive regulation of release of cytochrome c from mitochondria. Acts upstream of or within apoptotic process. Located in cytosol and perinuclear region of cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
