-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLCA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-150 of human CLCA4 (NP_036260.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLCA4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-150 of human CLCA4 (NP_036260.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06990A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLCA4 |
| Target Synonyms | CaCC; CaCC2; CLCA4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Rat uterus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-150 of human CLCA4 (NP_036260.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFIKLNNNGFEDIVIVIDPSVPEDEKIIEQIEDMVTTASTYLFEATEKRFFFKNVSILIPENWKENPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQFTECGEKGEYIHFTPDLLLGKKQNEYGPPG | Uniprot ID | Q14CN2 |
Uniprot Id
Q14CN2
Target Species
Human
Target Name
CLCA4
Target Full Name
Calcium-activated chloride channel regulator 4
Target Function
May be involved in mediating calcium-activated chloride conductance.
Target Subcellular Location
Cell membrane; Single-pass membrane protein. Apical cell membrane. Secreted.
Target Protein Families
CLCR family
Target Tissue Specificity
Primarily expressed in the digestive tract, mainly in colon. Detected in smaller amounts in brain, urogenital organs, testis, and salivary and mammary glands. Highly expressed in the epithelial layer and submucosal gland of the inferior turbinate mucosa.
Target Synonyms
30 kDa form; CaCC-2; Calcium-activated chloride channel family member 4; Calcium-activated chloride channel protein 2; Calcium-activated chloride channel regulator 4; Clca4; CLCA4_HUMAN; hCaCC-2; hCLCA4
Target Background
The protein encoded by this gene belongs to the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same site on chromosome 1p31-p22 and share high degrees of homology in size, sequence and predicted structure, but differ significantly in their tissue distributions. Alternative splicing results in multiple transcript variants, only one of which is thought to be protein coding.
Notification