-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CLDN10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN10 (NP_008915.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CLDN10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN10 (NP_008915.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00898A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CLDN10 |
| Target Synonyms | OSPL; HELIX; OSP-L; CPETRL3; CLDN10 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLDN10 (NP_008915.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFG | Uniprot ID | P78369 |
Uniprot Id
P78369
Target Species
Human
Target Name
CLDN10
Target Full Name
Claudin-10
Target Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Involved in the regulation of paracellular epithelia permeability to ions in multiple organs. It acts as a paracellular ion channel probably forming permselective pores; isoform 1 appears to create pores preferentially permeable to cations and isoform 2 for anions. In sweat glands and in the thick ascending limb (TAL) of Henle's loop in kidney, it controls paracellular sodium permeability which is essential for proper sweat production and renal function.
Target Involvement
HELIX syndrome (HELIX)
Target Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Target Protein Families
Claudin family
Target Tissue Specificity
Expressed in the kidney, eccrine sweat glands and in all layers of the epidermis. In the kidney, it is detected in the thick ascending limb of Henle's loop (TAL). In the sweat glands, it is expressed in cells from secretory portions, corresponding to the
Target Synonyms
CLDN10; Claudin-10; Oligodendrocyte-specific protein-like; OSP-like
Target Background
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The expression level of this gene is associated with recurrence of primary hepatocellular carcinoma. Six alternatively spliced transcript variants encoding different isoforms have been reported, but the transcript sequences of some variants are not determined.
Notification