Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CNNM4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-775 of human CNNM4 (NP_064569.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CNNM4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-775 of human CNNM4 (NP_064569.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06111A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CNNM4 |
| Target Synonyms | ACDP4; CNNM4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-775 of human CNNM4 (NP_064569.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKASHENAI | Uniprot ID | Q6P4Q7 |
Uniprot Id
Q6P4Q7
Target Species
Human
Target Name
CNNM4
Target Full Name
Metal transporter CNNM4
Target Function
Probable metal transporter. The interaction with the metal ion chaperone COX11 suggests that it may play a role in sensory neuron functions. May play a role in biomineralization and retinal function.
Target Involvement
Jalili syndrome (JALIS)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
ACDP family
Target Tissue Specificity
Widely expressed. Highly expressed in heart.
Target Synonyms
CNNM4; ACDP4; KIAA1592; Metal transporter CNNM4; Ancient conserved domain-containing protein 4; Cyclin-M4
Target Background
This gene encodes a member of the ancient conserved domain containing protein family. Members of this protein family contain a cyclin box motif and have structural similarity to the cyclins. The encoded protein may play a role in metal ion transport. Mutations in this gene are associated with Jalili syndrome which consists of cone-rod dystrophy and amelogenesis imperfecta.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
