-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COX11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human COX11 (NP_004366.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COX11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human COX11 (NP_004366.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06676A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COX11 |
| Target Synonyms | COX11P; MC4DN23; COX11 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human COX11 (NP_004366.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYID | Uniprot ID | Q9Y6N1 |
Uniprot Id
Q9Y6N1
Target Species
Human
Target Name
COX11
Target Full Name
Cytochrome c oxidase assembly protein COX11, mitochondrial
Target Function
Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side.
Target Protein Families
COX11/CtaG family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
COX11; COX11 homolog; COX11 homolog; cytochrome c oxidase assembly protein (yeast) ; COX11_HUMAN; COX11P; Cytochrome c oxidase assembly protein COX11; Cytochrome c oxidase assembly protein COX11; mitochondrial; Cytochrome c oxidase subunit 11; mitochondrial
Target Background
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be a heme A biosynthetic enzyme involved in COX formation, according to the yeast mutant studies. However, the studies in Rhodobacter sphaeroides suggest that this gene is not required for heme A biosynthesis, but required for stable formation of the Cu(B) and magnesium centers of COX. This human protein is predicted to contain a transmembrane domain localized in the mitochondrial inner membrane. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene has been found on chromosome 6.
Notification