-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against COX6B1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human COX6B1 (NP_001854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against COX6B1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human COX6B1 (NP_001854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06392A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | COX6B1 |
| Target Synonyms | COXG; COX6B; MC4DN7; COXVIb1; COX6B1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human COX6B1 (NP_001854.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI | Uniprot ID | P14854 |
Uniprot Id
P14854
Target Species
Human
Target Name
COX6B1
Target Full Name
Cytochrome c oxidase subunit 6B1
Target Function
Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Target Involvement
Mitochondrial complex IV deficiency (MT-C4D)
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side.
Target Protein Families
Cytochrome c oxidase subunit 6B family
Target Synonyms
COX 6B; COX VIb 1; COX VIb-1; COX6B; COX6B1; COXG; COXVIb1; CX6B1_HUMAN; Cytochrome c oxidase subunit 6B1; Cytochrome c oxidase subunit VIb; Cytochrome c oxidase subunit VIb isoform 1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); Cytochrome c oxidase subunit Vib polypeptide 1
Target Background
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively.
Notification