Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CPLX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human CPLX4 (NP_857637.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CPLX4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human CPLX4 (NP_857637.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05624A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CPLX4 |
| Target Synonyms | CPXIV; CPX-IV; CPLX4 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human CPLX4 (NP_857637.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAFLMKSMISNQVKNLGFGGGSEENKEEGGASDPAAAQGMTREEYEEYQKQMIEEKMERDAAFTQKKAERACLRVHLREKYRLPKSEMDENQIQMAGDDVDLPEDLRKMVDEDQEEEEDKDSILGQIQNLQNMDLDTIKEKAQATFTEIKQTAEQKCSVM | Uniprot ID | Q7Z7G2 |
Uniprot Id
Q7Z7G2
Target Species
Human
Target Name
CPLX4
Target Full Name
Complexin-4
Target Function
Complexin that regulates SNARE protein complex-mediated synaptic vesicle fusion. Required for the maintenance of synaptic ultrastructure in the adult retina. Positively regulates synaptic transmission through synaptic vesicle availability and exocytosis of neurotransmitters at photoreceptor ribbon synapses in the retina. Suppresses tonic photoreceptor activity and baseline 'noise' by suppression of Ca(2+) vesicle tonic release and the facilitation of evoked synchronous and asynchronous Ca(2+) vesicle release.
Target Subcellular Location
Cell junction, synapse. Cell membrane; Lipid-anchor.
Target Protein Families
Complexin/synaphin family
Target Synonyms
CPLX4Complexin-4; Complexin IV; CPX IV
Target Background
This gene likely encodes a member of the complexin family. The encoded protein may be involved in synaptic vesicle exocytosis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
