Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CPT1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-400 of human CPT1C (NP_001129524.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CPT1C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 270-400 of human CPT1C (NP_001129524.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05988A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CPT1C |
| Target Synonyms | CATL1; CPT1P; CPTIC; SPG73; CPT1-B; CPTI-B; CPT1C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 270-400 of human CPT1C (NP_001129524.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYRHRLNRQEIPPTLLMGMRPLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQQFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGA | Uniprot ID | Q8TCG5 |
Uniprot Id
Q8TCG5
Target Species
Human
Target Name
CPT1C
Target Full Name
Palmitoyl thioesterase CPT1C
Target Function
May play a role in lipid metabolic process.
Target Involvement
Spastic paraplegia 73, autosomal dominant (SPG73)
Target Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein. Cell junction, synapse. Cell projection, dendrite. Cell projection, axon. Endoplasmic reticulum.
Target Protein Families
Carnitine/choline acetyltransferase family
Target Tissue Specificity
Expressed predominantly in brain and testis. Expressed in motor neurons.
Target Synonyms
brain isoform; Carnitine acyltransferase like protein 1; Carnitine acyltransferase like protein1; Carnitine O palmitoyltransferase 1 brain isoform; Carnitine O palmitoyltransferase I; brain isoform; Carnitine O-palmitoyltransferase 1; Carnitine O-palmitoyltransferase I; Carnitine palmitoyltransferase 1; brain; Carnitine palmitoyltransferase 1C; Carnitine palmitoyltransferase I related C; Carnitine palmitoyltransferase1C; CAT L1; CATL 1; CATL1; CPT 1 like pseudogene; Cpt 1c; CPT 1P; CPT I C; CPT IC; Cpt1 c; CPT1 like pseudogene; CPT1-B; Cpt1c; CPT1C_HUMAN; CPT1P; CPTI-B; CPTIC
Target Background
This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein regulates the beta-oxidation and transport of long-chain fatty acids into mitochondria, and may play a role in the regulation of feeding behavior and whole-body energy homeostasis. Alternatively spliced transcript variants encoding multiple protein isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
