-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-133 of human CRB1 (NP_957705.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CRB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-133 of human CRB1 (NP_957705.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06761A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRB1 |
| Target Synonyms | LCA8; RP12; CRB1-A; CRB1-B; CRB1-C; CRB1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-133 of human CRB1 (NP_957705.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPV | Uniprot ID | P82279 |
Uniprot Id
P82279
Target Species
Human
Target Name
CRB1
Target Full Name
Protein crumbs homolog 1
Target Function
Plays a role in photoreceptor morphogenesis in the retina. May maintain cell polarization and adhesion.
Target Involvement
Retinitis pigmentosa 12 (RP12); Leber congenital amaurosis 8 (LCA8); Pigmented paravenous chorioretinal atrophy (PPCRA)
Target Subcellular Location
[Isoform 1]: Apical cell membrane; Single-pass type I membrane protein. Secreted. Cell projection, cilium, photoreceptor outer segment. Photoreceptor inner segment.; [Isoform 2]: Secreted.
Target Protein Families
Crumbs protein family
Target Tissue Specificity
Preferential expression in retina, also expressed in brain, testis, fetal brain and fetal eye. Expressed at the outer limiting membrane and apical to adherens junctions in the retina.
Target Synonyms
CRB1; CRUM1_HUMAN; Protein crumbs homolog 1
Target Background
This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.
Notification