-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRHR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-120 of human CRHR1 (NP_001138618.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CRHR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-120 of human CRHR1 (NP_001138618.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01389A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRHR1 |
| Target Synonyms | CRF1; CRHR; CRF-R; CRFR1; CRF-R1; CRFR-1; CRH-R1; CRHR1L; CRF-R-1; CRH-R-1; CRHR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HT-29, Mouse brain, Mouse liver, Mouse testis, SH-SY5Y, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-120 of human CRHR1 (NP_001138618.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV | Uniprot ID | P34998 |
Uniprot Id
P34998
Target Species
Human
Target Name
CRHR1
Target Full Name
Corticotropin-releasing factor receptor 1
Target Function
G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Note=Agonist-binding promotes endocytosis.
Target Protein Families
G-protein coupled receptor 2 family
Target Tissue Specificity
Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.
Target Research Area
Neuroscience
Target Synonyms
Corticotropin releasing factor type 1 receptor; corticotropin releasing hormone receptor 1; Corticotropin-releasing factor receptor 1; Corticotropin-releasing hormone receptor 1; CRF R; crf receptor 1; crf receptor type 1; crf type 1; CRF-R; CRF-R-1; CRF-R1; CRF1; CRFR; CRFR-1; CRFR1; CRFR1_HUMAN; CRH-R-1; CRH-R1; CRH-R1h; CRHR; Crhr1; CRHR1f; CRHR1L
Target Background
This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants. Naturally-occurring readthrough transcription between this gene and upstream GeneID:147081 results in transcripts that encode isoforms that share similarity with the products of this gene.
Notification