-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRMP2/DPYSL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 473-572 of human CRMP2/DPYSL2 (Q16555) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CRMP2/DPYSL2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 473-572 of human CRMP2/DPYSL2 (Q16555) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-17231A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRMP2/DPYSL2 |
| Target Synonyms | DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2; L2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Rat heart, Mouse lung, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 473-572 of human CRMP2/DPYSL2 (Q16555). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG | Uniprot ID | Q16555 |
Uniprot Id
Q16555
Target Species
Human
Target Name
DPYSL2
Target Full Name
Dihydropyrimidinase-related protein 2
Target Function
Plays a role in neuronal development and polarity, as well as in axon growth and guidance, neuronal growth cone collapse and cell migration. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. May play a role in endocytosis.
Target Subcellular Location
Cytoplasm, cytosol. Cytoplasm, cytoskeleton. Membrane. Note=Tightly but non-covalently associated with membranes.
Target Protein Families
Metallo-dependent hydrolases superfamily, Hydantoinase/dihydropyrimidinase family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Developmental Biology
Target Synonyms
Collapsin response mediator protein 2; Collapsin response mediator protein; Collapsin response mediator protein hCRMP 2; CRAM; CRMP 2; CRMP-2; CRMP2; DHPRP 2; DHPRP2; Dihydropyrimidinase 2; Dihydropyrimidinase like 2; Dihydropyrimidinase like 2 long form; Dihydropyrimidinase related protein 2; Dihydropyrimidinase-related protein 2; DPYL 2; DPYL2; DPYL2_HUMAN; DPYSL 2; Dpysl2; DRP-2; DRP2; Musunc 33; Musunc33; N2A3; TOAD 64; TOAD64; ULIP 2 protein; ULIP-2; Ulip2; Unc-33-like phosphoprotein 2
Target Background
This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification