Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRYGC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-174 of human CRYGC (NP_066269.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CRYGC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-174 of human CRYGC (NP_066269.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01004A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRYGC |
| Target Synonyms | CCL; CRYG3; CTRCT2; CRYGC | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-174 of human CRYGC (NP_066269.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGKITFYEDRAFQGRSYETTTDCPNLQPYFSRCNSIRVESGCWMLYERPNYQGQQYLLRRGEYPDYQQWMGLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY | Uniprot ID | P07315 |
Uniprot Id
P07315
Target Species
Human
Target Name
CRYGC
Target Full Name
Gamma-crystallin C
Target Function
Crystallins are the dominant structural components of the vertebrate eye lens.
Target Involvement
Cataract 2, multiple types (CTRCT2)
Target Protein Families
Beta/gamma-crystallin family
Target Synonyms
CATARACT; VARIABLE ZONULAR PULVERULENT; CCL; CRGC_HUMAN; CRYG 3; Cryg 5; Cryg; CRYG3; CRYGC; Crystallin gamma 3; Crystallin gamma C; Gamma C crystallin; Gamma crystallin 2 1; Gamma crystallin 3; Gamma crystallin C; Gamma-C-crystallin; Gamma-crystallin 2-1; Gamma-crystallin 3; Gamma-crystallin C; Gammab cry; Len
Target Background
This gene encodes a member of the beta/gamma-crystallin family of proteins. Crystallins constitute the major proteins of vertebrate eye lens and maintain the transparency and refractive index of the lens. This gene and several family members are present in a gene cluster on chromosome 2. Mutations in this gene have been shown to cause multiple types of cataract, including Coppock-like cataract and zonular pulverulent cataract, among others.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
