Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSMD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2050-2150 of human CSMD2 (NP_443128.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CSMD2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 2050-2150 of human CSMD2 (NP_443128.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10226A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSMD2 |
| Target Synonyms | dJ947L8.1; dJ1007G16.1; dJ1007G16.2; CSMD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 2050-2150 of human CSMD2 (NP_443128.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSHETTVYFHSDHSQNRPGFKLEYQDLTYSHQISSFLRGFDLSELERTNSTPPVAASYVWDLDPGCEAYELQECPDPEPFANGIVRGAGYNVGQSVTFECL | Uniprot ID | Q7Z408 |
Uniprot Id
Q7Z408
Target Species
Human
Target Name
CSMD2
Target Full Name
CUB and sushi domain-containing protein 2
Target Subcellular Location
Cell membrane; Single-pass membrane protein.
Target Protein Families
CSMD family
Target Tissue Specificity
Weakly expressed in most tissues, except in brain. Expressed at intermediate level in brain, including cerebellum, substantia nigra, hippocampus and fetal brain. Overexpressed in some head and neck cancer cell lines.
Target Synonyms
CSMD2; CSMD2_HUMAN; CUB and Sushi (SCR repeat) domain; CUB and sushi domain-containing protein 2; CUB and sushi multiple domains protein 2; dJ1007G16.1; dJ1007G16.2; dJ947L8.1; KIAA1884
Target Background
The protein encoded by this gene is thought to be involved in the control of complement cascade of the immune system. Defects in this gene have been associated with schizophrenia. This gene may act as a tumor suppressor for colorectal cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
