Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CSN2 (NP_001882.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CSN2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CSN2 (NP_001882.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12320A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSN2 |
| Target Synonyms | CASB; PDC213; CSN2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CSN2 (NP_001882.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKVLILACLVALALARETIESLSSSEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIME | Uniprot ID | P05814 |
Uniprot Id
P05814
Target Species
Human
Target Name
CSN2
Target Full Name
Beta-casein
Target Function
Important role in determination of the surface properties of the casein micelles.
Target Subcellular Location
Secreted.
Target Protein Families
Beta-casein family
Target Tissue Specificity
Mammary gland specific. Secreted in milk.
Target Synonyms
Beta-casein; CASB; CASB_HUMAN; Casein beta; CSN 2; Csn2
Target Background
This gene is a member of the beta casein family. There are two types of casein protein, beta (encoded by this gene) and kappa, both of which are secreted in human milk. Beta casein is the principal protein in human milk and the primary source of essential amino acids for a suckling infant. Beta and kappa casein proteins acting together form spherical micelles which bind within them important dietary minerals, such as calcium and phosphorous. In addition, the C-terminal 14 aa of the protein has antimicrobial activity, especially in preterm milk, displaying antibacterial activity against S. aureus and Y. enterocolitica. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
