-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CST6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-149 of human CST6 (NP_001314.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CST6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 29-149 of human CST6 (NP_001314.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00032A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CST6 |
| Target Synonyms | ECTD15; CST6 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 29-149 of human CST6 (NP_001314.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM | Uniprot ID | Q15828 |
Uniprot Id
Q15828
Target Species
Human
Target Name
CST6
Target Full Name
Cystatin-M
Target Function
High affinity inhibitor for cathepsin L, cathepsin L2 (cathepsin V), and legumain. Involved in the regulation of epidermal cornification, and hair follicle morphogenesis and maintenance.
Target Subcellular Location
Secreted.
Target Protein Families
Cystatin family
Target Tissue Specificity
Restricted to the stratum granulosum of normal skin, the stratum granulosum/spinosum of psoriatic skin, and the secretory coils of eccrine sweat glands. Low expression levels are found in the nasal cavity.
Target Synonyms
CST 6; CST6; Cystatin 6; Cystatin E; Cystatin E/M; Cystatin M; Cystatin M/E; Cystatin-6; Cystatin-E; Cystatin-M; Cystatin6; CystatinE; CystatinM; Cysteine proteinase inhibitor; CYTM_HUMAN
Target Background
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. This gene encodes a cystatin from the type 2 family, which is down-regulated in metastatic breast tumor cells as compared to primary tumor cells. Loss of expression is likely associated with the progression of a primary tumor to a metastatic phenotype.
Notification