-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CTBP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 345-445 of human CTBP2 (NP_001320.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CTBP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 345-445 of human CTBP2 (NP_001320.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09890A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CTBP2 |
| Target Synonyms | CTBP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, BxPC-3, Mouse brain, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 345-445 of human CTBP2 (NP_001320.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ITGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ | Uniprot ID | P56545 |
Uniprot Id
P56545
Target Species
Human
Target Name
CTBP2
Target Full Name
C-terminal-binding protein 2
Target Function
Corepressor targeting diverse transcription regulators. Functions in brown adipose tissue (BAT) differentiation.; Isoform 2 probably acts as a scaffold for specialized synapses.
Target Subcellular Location
Nucleus. Cell junction, synapse.
Target Protein Families
D-isomer specific 2-hydroxyacid dehydrogenase family
Target Tissue Specificity
Ubiquitous. Highest levels in heart, skeletal muscle, and pancreas.
Target Synonyms
C terminal binding protein 2; C-terminal-binding protein 2; CtBP2; CTBP2_HUMAN; ribeye
Target Background
This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene.
Notification