-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CTSC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-134 of human CTSC (NP_001805.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CTSC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-134 of human CTSC (NP_001805.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09033A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CTSC |
| Target Synonyms | JP; HMS; JPD; PLS; CPPI; DPP1; DPPI; PALS; DPP-I; PDON1; CTSC | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-134 of human CTSC (NP_001805.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DTPANCTYLDLLGTWVFQVGSSGSQRDVNCSVMGPQEKKVVVYLQKLDTAYDDLGNSGHFTIIYNQGFEIVLNDYKWFAFFKYKEEGSKVTTYCNETMTGWVHDVLGRNW | Uniprot ID | P53634 |
Uniprot Id
P53634
Target Species
Human
Target Name
CTSC
Target Full Name
Dipeptidyl peptidase 1
Target Function
Thiol protease. Has dipeptidylpeptidase activity. Active against a broad range of dipeptide substrates composed of both polar and hydrophobic amino acids. Proline cannot occupy the P1 position and arginine cannot occupy the P2 position of the substrate. Can act as both an exopeptidase and endopeptidase. Activates serine proteases such as elastase, cathepsin G and granzymes A and B. Can also activate neuraminidase and factor XIII.
Target Involvement
Papillon-Lefevre syndrome (PLS); Haim-Munk syndrome (HMS); Periodontititis, aggressive, 1 (AP1)
Target Subcellular Location
Lysosome.
Target Protein Families
Peptidase C1 family
Target Tissue Specificity
Ubiquitous. Highly expressed in lung, kidney and placenta. Detected at intermediate levels in colon, small intestine, spleen and pancreas.
Target Synonyms
AI047818; CATC; CATC_HUMAN; Cathepsin C; Cathepsin J; CPPI; CTSC; Dipeptidyl peptidase 1; Dipeptidyl peptidase 1 light chain; Dipeptidyl peptidase I; Dipeptidyl peptidase I exclusion domain chain; Dipeptidyl peptidase I heavy chain; Dipeptidyl peptidase I light chain; Dipeptidyl transferase; DPP I; DPP-I; DPPI; EC 3.4.14.1; HMS; JP; JPD; MGC126959 ; PALS; PDON1; PLS
Target Background
This gene encodes a member of the peptidase C1 family and lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in cells of the immune system. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate heavy and light chains that form a disulfide-linked dimer. A portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis.
Notification