-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CXCL13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-109 of human CXCL13 (NP_006410.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CXCL13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-109 of human CXCL13 (NP_006410.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04839A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CXCL13 |
| Target Synonyms | BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13; CXCL13 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse spleen, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-109 of human CXCL13 (NP_006410.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP | Uniprot ID | O43927 |
Uniprot Id
O43927
Target Species
Human
Target Name
CXCL13
Target Full Name
C-X-C motif chemokine 13
Target Function
Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine alpha (chemokine CxC) family
Target Tissue Specificity
Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.
Target Research Area
Immunology
Target Synonyms
ANGIE; ANGIE2 ; B cell attracting chemokine 1; B cell-attracting chemokine 1; B lymphocyte chemoattractant; B-cell chemoattractant ; B-cell-attracting chemokine 1; B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); BCA-1; BLC; BLR1L ; C-X-C motif chemokine 13; Chemokine (C-X-C motif) ligand 13 ; Chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant) ; Chemokine; CXC motif; ligand 13; CXC chemokine BLC; CXCL13; CXL13_HUMAN; SCYB13; Small inducible cytokine B subfamily (Cys-X-Cys motif); member 13 (B-cell chemoattractant); Small inducible cytokine B13; Small inducible cytokine subfamily B; member 13; Small-inducible cytokine B13
Target Background
B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles.
Notification