-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 6 (KRT6) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 465-564 of human Cytokeratin 6 (KRT6) (P48668) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Cytokeratin 6 (KRT6) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 465-564 of human Cytokeratin 6 (KRT6) (P48668) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14294A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 6 (KRT6) |
| Target Synonyms | K6E; KRT6E; PPKNEFD; Cytokeratin 6 (KRT6) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 5637, A-431 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 465-564 of human Cytokeratin 6 (KRT6) (P48668). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YRKLLEGEECRLNGEGVGQVNVSVVQSTISSGYGGASGVGSGLGLGGGSSYSYGSGLGIGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH | Uniprot ID | P48668 |
Uniprot Id
P48668
Target Species
Human
Target Name
KRT6C
Target Full Name
Keratin, type II cytoskeletal 6C
Target Involvement
Palmoplantar keratoderma, non-epidermolytic, focal or diffuse (PPKNEFD)
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Constitutively expressed in distinct types of epithelia such as those in oral mucosa, esophagus, papillae of tongue and hair follicle outer root sheath.
Target Synonyms
CK 6A; CK 6B; CK 6C; CK 6D; CK 6E; CK-6B; CK-6C; CK-6E; Cytokeratin 6a; Cytokeratin 6B; Cytokeratin 6C; Cytokeratin 6D; Cytokeratin 6E; Cytokeratin-6B; Cytokeratin-6C; Cytokeratin-6E; K2C6C_HUMAN; K6a keratin; K6b keratin; K6C; K6c keratin; K6d keratin; K6e keratin; Keratin; Keratin K6h; Keratin type II cytoskeletal 6A; Keratin type II cytoskeletal 6B; Keratin type II cytoskeletal 6C; Keratin type II cytoskeletal 6D; Keratin type II cytoskeletal 6E; Keratin-6C; KRT6A; KRT6B; KRT6C; KRT6D; KRT6E; type II cytoskeletal 6C; Type-II keratin Kb12
Target Background
Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. The type II keratins are clustered in a region of chromosome 12q13.
Notification