-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 6 (KRT6) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 6 (KRT6) (NP_005545.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cytokeratin 6 (KRT6) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 6 (KRT6) (NP_005545.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09309A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 6 (KRT6) |
| Target Synonyms | K6A; K6C; K6D; PC3; CK6A; CK6C; CK6D; CK-6C; CK-6E; KRT6C; KRT6D; Cytokeratin 6 (KRT6) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 6 (KRT6) (NP_005545.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF | Uniprot ID | P02538 |
Uniprot Id
P02538
Target Species
Human
Target Name
KRT6A
Target Full Name
Keratin, type II cytoskeletal 6A
Target Function
Epidermis-specific type I keratin involved in wound healing. Involved in the activation of follicular keratinocytes after wounding, while it does not play a major role in keratinocyte proliferation or migration. Participates in the regulation of epithelial migration by inhibiting the activity of SRC during wound repair.
Target Involvement
Pachyonychia congenita 3 (PC3)
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in the corneal epithelium (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
CK-6A; CK-6D; CK6A; CK6C; CK6D; Cytokeratin-6A; Cytokeratin-6D; K2C6A_HUMAN; K6A; K6C ; K6D; keratin 6A; Keratin; Keratin; type II cytoskeletal 6A; Keratin-6A; Krt6a; KRT6C; KRT6D; type II cytoskeletal 6A; Type-II keratin Kb6
Target Background
The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. As many as six of this type II cytokeratin (KRT6) have been identified; the multiplicity of the genes is attributed to successive gene duplication events. The genes are expressed with family members KRT16 and/or KRT17 in the filiform papillae of the tongue, the stratified epithelial lining of oral mucosa and esophagus, the outer root sheath of hair follicles, and the glandular epithelia. This KRT6 gene in particular encodes the most abundant isoform. Mutations in these genes have been associated with pachyonychia congenita. In addition, peptides from the C-terminal region of the protein have antimicrobial activity against bacterial pathogens. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.
Notification