Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCAF17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 235-335 of human DCAF17 (NP_079276.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DCAF17 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 235-335 of human DCAF17 (NP_079276.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07089A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCAF17 |
| Target Synonyms | C2orf37; C20orf37; DCAF17 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 235-335 of human DCAF17 (NP_079276.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LYSFQTIAEQFMQQKLDLGCACRWGGTTGTVGEAPFGIPCNIKITDMPPLLFEVSSLENAFQIGGHPWHYIVTPNKKKQKGVFHICALKDNSLAKNGIQEM | Uniprot ID | Q5H9S7 |
Uniprot Id
Q5H9S7
Target Species
Human
Target Name
DCAF17
Target Full Name
DDB1- and CUL4-associated factor 17
Target Function
May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Target Involvement
Woodhouse-Sakati syndrome (WoSaS)
Target Subcellular Location
Membrane; Multi-pass membrane protein. Nucleus, nucleolus. Note=According to PubMed:19026396, it is a nucleolar protein, while sequence analysis programs clearly predict 2 transmembrane regions.
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
DCAF17; C2orf37; DDB1- and CUL4-associated factor 17
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
