Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DCAF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DCAF4 (NP_056419.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DCAF4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DCAF4 (NP_056419.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05408A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DCAF4 |
| Target Synonyms | WDR21; WDR21A; DCAF4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human DCAF4 (NP_056419.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNKSRWQSRRRHGRRSHQQNPWFRLRDSEDRSDSRAAQPAHDSGHGDDESPSTSSGTAGTSSVPELPGFYFDPEKKRYFRLLPGHNNCNPLTKESIRQKEMESKRLRLLQEEDRRKKIAR | Uniprot ID | Q8WV16 |
Uniprot Id
Q8WV16
Target Species
Human
Target Name
DCAF4
Target Full Name
DDB1- and CUL4-associated factor 4
Target Function
May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.
Target Research Area
Cell Biology
Target Synonyms
DCAF4; DCAF4_HUMAN; DDB1 and CUL4 associated factor 4; DDB1- and CUL4-associated factor 4; WD repeat domain 21; WD repeat domain 21A; WD repeat-containing protein 21A; WDR21 ; WDR21A
Target Background
This gene encodes a WD repeat-containing protein that interacts with the Cul4-Ddb1 E3 ligase macromolecular complex. Multiple alternatively spliced transcript variants have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
