Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDX31 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 652-851 of human DDX31 (NP_073616.6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DDX31 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 652-851 of human DDX31 (NP_073616.6) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10037A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDX31 |
| Target Synonyms | PPP1R25; DDX31 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 652-851 of human DDX31 (NP_073616.6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EIKMEDILCVLTRDDCFKGKRWGAQKSHAVGPQEIRERATVLQTVFEDYVHSSERRVSWAKKALQSFIQAYATYPRELKHIFHVRSLHLGHVAKSFGLRDAPRNLSALTRKKRKAHVKRPDLHKKTQSKHSLAEILRSEYSSGMEADIAKVKKQNAPGEPGGRPLQHSLQPTPCFGRGKTLKWRKTQKGVQRDSKTSQKV | Uniprot ID | Q9H8H2 |
Uniprot Id
Q9H8H2
Target Species
Human
Target Name
DDX31
Target Full Name
ATP-dependent DNA helicase DDX31
Target Function
Probable ATP-dependent RNA helicase. Plays a role in ribosome biogenesis and TP53/p53 regulation through its interaction with NPM1.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
DEAD box helicase family, DDX31/DBP7 subfamily
Target Tissue Specificity
Weakly or undetectably expressed in normal organs. Up-regulated in renal cell carcinoma.
Target Synonyms
DDX31Probable ATP-dependent RNA helicase DDX31; EC 3.6.4.13; DEAD box protein 31; Helicain
Target Background
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
