-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDX6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human DDX6 (P26196) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DDX6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human DDX6 (P26196) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16154A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDX6 |
| Target Synonyms | P54; RCK; HLR2; IDDILF; Rck/p54; DDX6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C2C12, Hep G2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human DDX6 (P26196). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATT | Uniprot ID | P26196 |
Uniprot Id
P26196
Target Species
Human
Target Name
DDX6
Target Full Name
Probable ATP-dependent RNA helicase DDX6
Target Function
Essential for the formation of P-bodies, cytosolic membrane-less ribonucleoprotein granules involved in RNA metabolism through the coordinated storage of mRNAs encoding regulatory functions. Plays a role in P-bodies to coordinate the storage of translationally inactive mRNAs in the cytoplasm and prevent their degradation. In the process of mRNA degradation, plays a role in mRNA decapping. Blocks autophagy in nutrient-rich conditions by repressing the expression of ATG-related genes through degradation of their transcripts.
Target Involvement
A chromosomal aberration involving DDX6 may be a cause of hematopoietic tumors such as B-cell lymphomas. Translocation t(11;14)(q23;q32).
Target Subcellular Location
Cytoplasm, P-body. Cytoplasm. Nucleus.
Target Protein Families
DEAD box helicase family, DDX6/DHH1 subfamily
Target Tissue Specificity
Abundantly expressed in most tissues.
Target Synonyms
DDX6; HLR2; RCK; Probable ATP-dependent RNA helicase DDX6; EC 3.6.4.13; ATP-dependent RNA helicase p54; DEAD box protein 6; Oncogene RCK
Target Background
This gene encodes a member of the DEAD box protein family. The protein is an RNA helicase found in P-bodies and stress granules, and functions in translation suppression and mRNA degradation. It is required for microRNA-induced gene silencing. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Notification