-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DENR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human DENR (NP_003668.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against DENR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human DENR (NP_003668.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06104A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DENR |
| Target Synonyms | DRP; DRP1; SMAP-3; DENR | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, BxPC-3, Jurkat, Rat lung, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human DENR (NP_003668.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK | Uniprot ID | O43583 |
Uniprot Id
O43583
Target Species
Human
Target Name
DENR
Target Full Name
Density-regulated protein
Target Function
May be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Involved in translation initiation; promotes recruitmnet of aminoacetyled initiator tRNA to P site of 40S ribosomes. Can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits. Plays a role in the modulation of the translational profile of a subset of cancer-related mRNAs when recruited to the translational initiation complex by the oncogene MCTS1.
Target Protein Families
DENR family
Target Tissue Specificity
Highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. Weakly expressed in the lung and kidney.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
denr; DENR_HUMAN; Density regulated protein; Density-regulated protein; DRP; DRP1; DRP1 protein; Protein DRP1; SMAP-3; SMAP3; Smooth muscle cell associated protein 3; Smooth muscle cell-associated protein 3
Target Background
This gene encodes a protein whose expression was found to increase in cultured cells at high density but not during growth arrest. This gene was also shown to have increased expression in cells overexpressing HER-2/neu proto-oncogene. The protein contains an SUI1 domain. In budding yeast, SUI1 is a translation initiation factor that along with eIF-2 and the initiator tRNA-Met, directs the ribosome to the proper translation start site. Proteins similar to SUI have been found in mammals, insects, and plants.
Notification