-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DHX38 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1133-1227 of human DHX38 (NP_054722.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DHX38 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1133-1227 of human DHX38 (NP_054722.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03969A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DHX38 |
| Target Synonyms | RP84; DDX38; PRP16; PRPF16; DHX38 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, DU145, MCF7, Mouse testis, Mouse thymus, SKOV3, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1133-1227 of human DHX38 (NP_054722.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VTAVDGEWLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL | Uniprot ID | Q92620 |
Uniprot Id
Q92620
Target Species
Human
Target Name
DHX38
Target Full Name
Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16
Target Function
Probable ATP-binding RNA helicase (Probable). Involved in pre-mRNA splicing as component of the spliceosome.
Target Subcellular Location
Nucleus.
Target Protein Families
DEAD box helicase family, DEAH subfamily, PRP16 sub-subfamily
Target Synonyms
ATP dependent RNA helicase DHX38; ATP-dependent RNA helicase DHX38; DDX38; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38; DEAH (Asp-Glu-Ala-His) box polypeptide 38; DEAH box protein 38; DHX38; KIAA0224; Pre mRNA splicing factor ATP dependent RNA helicase PRP16; Pre-mRNA splicing factor 16 ; Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16; Prp16; PRP16 homolog of S.cerevisiae, pre-mRNA splicing factor ATP-dependent RNA helicase PRP16; PRP16_HUMAN; PRPF16
Target Background
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a member of the DEAD/H box family of splicing factors. This protein resembles yeast Prp16 more closely than other DEAD/H family members. It is an ATPase and essential for the catalytic step II in pre-mRNA splicing process.
Notification