-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DOK5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 237-306 of human DOK5 (NP_060901.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DOK5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 237-306 of human DOK5 (NP_060901.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06081A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DOK5 |
| Target Synonyms | IRS6; IRS-6; C20orf180; DOK5 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 237-306 of human DOK5 (NP_060901.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLQSVKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQLYRLQDVSSPLKLHRTETFPAYRSEH | Uniprot ID | Q9P104 |
Uniprot Id
Q9P104
Target Species
Human
Target Name
DOK5
Target Full Name
Docking protein 5
Target Function
DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK5 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway. Putative link with downstream effectors of RET in neuronal differentiation.
Target Protein Families
DOK family, Type B subfamily
Target Tissue Specificity
Highest expression in skeletal muscle, lower in brain, heart and kidney. Also detected in activated peripheral blood T-lymphocytes.
Target Research Area
Signal Transduction
Target Synonyms
chromosome 20 open reading frame 180; Docking protein 5; DOK 5; DOK5; DOK5 protein; DOK5_HUMAN; Downstream of tyrosine kinase 5; Insulin receptor substrate 6; IRS-6; IRS6
Target Background
The protein encoded by this gene is a member of the DOK family of membrane proteins, which are adapter proteins involved in signal transduction. The encoded protein interacts with phosphorylated receptor tyrosine kinases to mediate neurite outgrowth and activation of the MAP kinase pathway. Unlike other DOK family proteins, this protein does not interact with RASGAP. This protein is up-regulated in patients with systemic sclerosis and is associated with fibrosis induced by insulin-like growth factor binding protein 5. Alternative splicing of this gene results in multiple transcript variants.
Notification