Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DPPA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DPPA2 (NP_620170.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DPPA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DPPA2 (NP_620170.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05340A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DPPA2 |
| Target Synonyms | CT100; PESCRG1; ECAT15-2; DPPA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, Mouse ovary, Mouse uterus, Rat ovary, Rat uterus, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DPPA2 (NP_620170.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPK | Uniprot ID | Q7Z7J5 |
Uniprot Id
Q7Z7J5
Target Species
Human
Target Name
DPPA2
Target Full Name
Developmental pluripotency-associated protein 2
Target Function
Binds to target gene promoters, including NKX2-5 and SYCE1, but not GATA4, and may be involved in the maintenance of the active epigenetic status of these genes.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in embryonic stem cells. No expression is seen in 5 months embryo, mesenchymal stem cells, embryonic fibrocytes and adult tissues.
Target Synonyms
DPPA2; PESCRG1Developmental pluripotency-associated protein 2; Pluripotent embryonic stem cell-related gene 1 protein
Target Background
Predicted to enable chromatin binding activity. Predicted to be involved in system development. Predicted to act upstream of or within several processes, including lung-associated mesenchyme development; positive regulation of stem cell proliferation; and regulation of histone methylation. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
