Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DRD5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 323-477 of human DRD5 (NP_000789.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DRD5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 323-477 of human DRD5 (NP_000789.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11337A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DRD5 |
| Target Synonyms | DBDR; DRD1B; DRD1L2; DRD5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 323-477 of human DRD5 (NP_000789.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH | Uniprot ID | P21918 |
Uniprot Id
P21918
Target Species
Human
Target Name
DRD5
Target Full Name
D(1B) dopamine receptor
Target Function
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Target Involvement
Benign essential blepharospasm (BEB)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Neuron-specific, localized primarily within limbic regions of the brain.
Target Synonyms
DRD5; DRD1B; DRD1L2; D(1B dopamine receptor; D(5 dopamine receptor; D1beta dopamine receptor; Dopamine D5 receptor
Target Background
This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
