Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ECE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 670-770 of human ECE1 (NP_001388.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ECE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 670-770 of human ECE1 (NP_001388.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07892A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ECE1 |
| Target Synonyms | ECE; ECE1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 670-770 of human ECE1 (NP_001388.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW | Uniprot ID | P42892 |
Uniprot Id
P42892
Target Species
Human
Target Name
ECE1
Target Full Name
Endothelin-converting enzyme 1
Target Function
Converts big endothelin-1 to endothelin-1.
Target Involvement
Hirschsprung disease, cardiac defects, and autonomic dysfunction (HCAD)
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.
Target Protein Families
Peptidase M13 family
Target Tissue Specificity
All isoforms are expressed in umbilical vein endothelial cells, polynuclear neutrophils, fibroblasts, atrium cardiomyocytes and ventricles. Isoforms A, B and C are also expressed in placenta, lung, heart, adrenal gland and phaeochromocytoma; isoforms A an
Target Synonyms
ECE1; Endothelin-converting enzyme 1
Target Background
The protein encoded by this gene is involved in proteolytic processing of endothelin precursors to biologically active peptides. Mutations in this gene are associated with Hirschsprung disease, cardiac defects and autonomic dysfunction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
