-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EGFR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human EGFR (NP_005219.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EGFR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human EGFR (NP_005219.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17239A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EGFR |
| Target Synonyms | ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2; FR | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human EGFR (NP_005219.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGL | Uniprot ID | P00533 |
Uniprot Id
P00533
Target Species
Human
Target Name
EGFR
Target Full Name
Epidermal growth factor receptor
Target Function
Receptor tyrosine kinase binding ligands of the EGF family and activating several signaling cascades to convert extracellular cues into appropriate cellular responses. Known ligands include EGF, TGFA/TGF-alpha, AREG, epigen/EPGN, BTC/betacellulin, epiregulin/EREG and HBEGF/heparin-binding EGF. Ligand binding triggers receptor homo- and/or heterodimerization and autophosphorylation on key cytoplasmic residues. The phosphorylated receptor recruits adapter proteins like GRB2 which in turn activates complex downstream signaling cascades. Activates at least 4 major downstream signaling cascades including the RAS-RAF-MEK-ERK, PI3 kinase-AKT, PLCgamma-PKC and STATs modules. May also activate the NF-kappa-B signaling cascade. Also directly phosphorylates other proteins like RGS16, activating its GTPase activity and probably coupling the EGF receptor signaling to the G protein-coupled receptor signaling. Also phosphorylates MUC1 and increases its interaction with SRC and CTNNB1/beta-catenin. Positively regulates cell migration via interaction with CCDC88A/GIV which retains EGFR at the cell membrane following ligand stimulation, promoting EGFR signaling which triggers cell migration. Plays a role in enhancing learning and memory performance.; Isoform 2 may act as an antagonist of EGF action.; (Microbial infection) Acts as a receptor for hepatitis C virus (HCV) in hepatocytes and facilitates its cell entry. Mediates HCV entry by promoting the formation of the CD81-CLDN1 receptor complexes that are essential for HCV entry and by enhancing membrane fusion of cells expressing HCV envelope glycoproteins.
Target Involvement
Lung cancer (LNCR); Inflammatory skin and bowel disease, neonatal, 2 (NISBD2)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein. Nucleus membrane; Single-pass type I membrane protein. Endosome. Endosome membrane. Nucleus.; [Isoform 2]: Secreted.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, EGF receptor subfamily
Target Tissue Specificity
Ubiquitously expressed. Isoform 2 is also expressed in ovarian cancers.
Target Research Area
Cancer
Target Synonyms
Avian erythroblastic leukemia viral (v erb b) oncogene homolog; Cell growth inhibiting protein 40; Cell proliferation inducing protein 61; EGF R; EGFR; EGFR_HUMAN; Epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog); Epidermal growth factor receptor (erythroblastic leukemia viral (v erb b) oncogene homolog avian); Epidermal growth factor receptor; erb-b2 receptor tyrosine kinase 1; ERBB; ERBB1; Errp; HER1; mENA; NISBD2; Oncogen ERBB; PIG61; Proto-oncogene c-ErbB-1; Receptor tyrosine protein kinase ErbB 1; Receptor tyrosine-protein kinase ErbB-1; SA7; Species antigen 7; Urogastrone; v-erb-b Avian erythroblastic leukemia viral oncogen homolog; wa2; Wa5
Target Background
The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).
Notification