-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EHF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of human EHF (NP_036285.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EHF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of human EHF (NP_036285.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05841A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EHF |
| Target Synonyms | ESE3; ESEJ; ESE3B; EHF | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-113 of human EHF (NP_036285.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKW | Uniprot ID | Q9NZC4 |
Uniprot Id
Q9NZC4
Target Species
Human
Target Name
EHF
Target Full Name
ETS homologous factor
Target Function
Transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. May act as a repressor for a specific subset of ETS/AP-1-responsive genes and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. Binds to DNA sequences containing the consensus nucleotide core sequence GGAA. Involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter. May contribute to development and carcinogenesis by acting as a tumor suppressor gene or anti-oncogene.
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Tissue Specificity
Expressed exclusively in tissues with a high content of epithelial cells. Highly expressed in salivary gland, mammary gland, prostate, and lung. Weakly expressed in kidney and colon. Not detected in heart, brain, placenta, liver, skeletal muscle, spleen,
Target Synonyms
EHF; EHF_HUMAN; Epithelium-specific Ets transcription factor 3; ESE-3; ESE3; ESE3 transcription factor; ESE3B; ESEJ; Ets domain transcription factor; ETS domain-containing transcription factor; ETS homologous factor; hEHF
Target Background
This gene encodes a protein that belongs to an ETS transcription factor subfamily characterized by epithelial-specific expression (ESEs). The encoded protein acts as a transcriptional repressor and may be involved in epithelial differentiation and carcinogenesis. Three transcript variants encoding different isoforms have been found for this gene.
Notification