-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human ELF5 (NP_938195.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against ELF5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human ELF5 (NP_938195.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-02642A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELF5 |
| Target Synonyms | ESE2; ELF5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat kidney, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human ELF5 (NP_938195.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EEYYPAFEHQTACDSYWTSVHPEYWTKRHVWEWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESKATIKDYADSN | Uniprot ID | Q9UKW6 |
Uniprot Id
Q9UKW6
Target Species
Human
Target Name
ELF5
Target Full Name
ETS-related transcription factor Elf-5
Target Function
Transcriptionally activator that may play a role in regulating the later stages of keratinocytes terminal differentiation.; Isoform 2 binds to DNA sequences containing the consensus nucleotide core sequence GGA[AT]. Transcriptionally activates SPRR2A and the parotid gland-specific PSP promoters.
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Tissue Specificity
Expressed exclusively in tissues with a high content of epithelial cells. Highly expressed in salivary gland, mammary gland, kidney and prostate. Weakly expressed in placenta and lung. Isoform 1 and isoform 2 are differentially expressed in different tiss
Target Synonyms
E74 like factor 5 (ets domain transcription factor); E74 like factor 5; E74-like factor 5; ELF 5; ELF5; ELF5_HUMAN; Epithelium restricted ESE 1 related Ets factor; Epithelium restricted ESE1 related Ets factor; Epithelium specific Ets transcription factor 2; Epithelium-restricted ESE-1-related Ets factor; Epithelium-specific Ets transcription factor 2; ESE 2; ESE-2; ESE2; Ets domain TF; Ets domain transcription factor; ETS related transcription factor Elf 5; ETS related transcription factor Elf5; ETS-related transcription factor Elf-5
Target Background
This gene encodes an epithelium-specific ETS family transcription factor. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. This gene has been implicated as a tumor suppressive transcription factor in breast cancer.
Notification