-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERCC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ERCC1 (P07992) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ERCC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ERCC1 (P07992) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13282A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERCC1 |
| Target Synonyms | UV20; COFS4; RAD10; ERCC1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ERCC1 (P07992). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAW | Uniprot ID | P07992 |
Uniprot Id
P07992
Target Species
Human
Target Name
ERCC1
Target Full Name
DNA excision repair protein ERCC-1
Target Function
Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4.; Not functional in the nucleotide excision repair pathway.; Not functional in the nucleotide excision repair pathway.; Not functional in the nucleotide excision repair pathway.
Target Involvement
Cerebro-oculo-facio-skeletal syndrome 4 (COFS4)
Target Subcellular Location
[Isoform 1]: Nucleus.; [Isoform 2]: Cytoplasm. Nucleus.; [Isoform 3]: Nucleus.; [Isoform 4]: Nucleus.
Target Protein Families
ERCC1/RAD10/SWI10 family
Target Synonyms
COFS 4; COFS4 ; DNA excision repair protein ERCC 1; DNA excision repair protein ERCC-1; DNA excision repair protein ERCC1; ERCC 1; ERCC1; ERCC1_HUMAN; Excision repair cross complementation group 1; Excision repair cross complementing 1; Excision Repair Cross Complementing Rodent Repair Deficiency Complementation Group 1; Excision repair protein; RAD 10; RAD10; UV 20; UV20
Target Background
The product of this gene functions in the nucleotide excision repair pathway, and is required for the repair of DNA lesions such as those induced by UV light or formed by electrophilic compounds including cisplatin. The encoded protein forms a heterodimer with the XPF endonuclease (also known as ERCC4), and the heterodimeric endonuclease catalyzes the 5' incision in the process of excising the DNA lesion. The heterodimeric endonuclease is also involved in recombinational DNA repair and in the repair of inter-strand crosslinks. Mutations in this gene result in cerebrooculofacioskeletal syndrome, and polymorphisms that alter expression of this gene may play a role in carcinogenesis. Multiple transcript variants encoding different isoforms have been found for this gene. The last exon of this gene overlaps with the CD3e molecule, epsilon associated protein gene on the opposite strand.
Notification