-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERK5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 717-816 of human ERK5 (Q13164) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ERK5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 717-816 of human ERK5 (Q13164) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13817A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERK5 |
| Target Synonyms | BMK1; ERK4; ERK5; PRKM7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Mouse brain, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 717-816 of human ERK5 (Q13164). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQDP | Uniprot ID | Q13164 |
Uniprot Id
Q13164
Target Species
Human
Target Name
MAPK7
Target Full Name
Mitogen-activated protein kinase 7
Target Function
Plays a role in various cellular processes such as proliferation, differentiation and cell survival. The upstream activator of MAPK7 is the MAPK kinase MAP2K5. Upon activation, it translocates to the nucleus and phosphorylates various downstream targets including MEF2C. EGF activates MAPK7 through a Ras-independent and MAP2K5-dependent pathway. May have a role in muscle cell differentiation. May be important for endothelial function and maintenance of blood vessel integrity. MAP2K5 and MAPK7 interact specifically with one another and not with MEK1/ERK1 or MEK2/ERK2 pathways. Phosphorylates SGK1 at Ser-78 and this is required for growth factor-induced cell cycle progression. Involved in the regulation of p53/TP53 by disrupting the PML-MDM2 interaction.
Target Subcellular Location
Cytoplasm. Nucleus. Nucleus, PML body. Note=Translocates to the nucleus upon activation.
Target Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily
Target Tissue Specificity
Expressed in many adult tissues. Abundant in heart, placenta, lung, kidney and skeletal muscle. Not detectable in liver.
Target Synonyms
Big MAP kinase 1; BMK 1; BMK 1 kinase; BMK-1; BMK1; BMK1 Kinase; EC 2.7.11.24; ERK 4; ERK 5; ERK-5; ERK4; ERK5; Extracellular signal regulated kinase 5; Extracellular signal-regulated kinase 5; MAP kinase 7; MAPK 7; MAPK7; Mitogen activated protein kinase 7; Mitogen-activated protein kinase 7; MK07_HUMAN; OTTHUMP00000065906; OTTHUMP00000065907; PRKM 7; PRKM7; PROTEIN KINASE; MITOGEN-ACTIVATED; 7
Target Background
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is specifically activated by mitogen-activated protein kinase kinase 5 (MAP2K5/MEK5). It is involved in the downstream signaling processes of various receptor molecules including receptor type kinases, and G protein-coupled receptors. In response to extracelluar signals, this kinase translocates to cell nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors. Four alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
Notification