Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ETS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 76-170 of human ETS2 (NP_005230.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ETS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 76-170 of human ETS2 (NP_005230.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02570A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ETS2 |
| Target Synonyms | ETS2IT1; ETS2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 76-170 of human ETS2 (NP_005230.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKEN | Uniprot ID | P15036 |
Uniprot Id
P15036
Target Species
Human
Target Name
ETS2
Target Full Name
Protein C-ets-2
Target Function
Transcription factor activating transcription. Binds specifically the DNA GGAA/T core motif (Ets-binding site or EBS) in gene promoters and stimulates transcription.
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Synonyms
C ets 2 protein; ETS2; ETS2_HUMAN; ETS2IT1; Oncogene ETS 2; Oncogene ETS2; Protein C-ets-2; v ets avian erythroblastosis virus E2 oncogene homolog 2; V ets avian erythroblastosis virus E26 oncogene homolog 2; V ets erythroblastosis virus E26 oncogene homolog 2
Target Background
This gene encodes a transcription factor which regulates genes involved in development and apoptosis. The encoded protein is also a protooncogene and shown to be involved in regulation of telomerase. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
